PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009616121.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 399aa    MW: 45337.1 Da    PI: 7.4936
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009616121.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.75.4e-54221491128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL+ kv + ++     i+evd++++ePw+Lp+ +k +e+ewyfFs rd+ky+tg r+nrat +gyWkatgkd+ev+s+
  XP_009616121.1  22 LPPGFRFHPTDEELITFYLASKVFNGTFCG-IQIAEVDLNRCEPWELPEVAKMGEREWYFFSLRDRKYPTGLRTNRATGAGYWKATGKDREVYSA 115
                     79*************************877.67***************8888999**************************************99 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +g+l g+kktLvfykgrapkgekt+Wvmheyrl
  XP_009616121.1 116 tNGALLGMKKTLVFYKGRAPKGEKTKWVMHEYRL 149
                     78899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-6317171IPR003441NAC domain
PROSITE profilePS5100559.51322171IPR003441NAC domain
PfamPF023651.0E-2723149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010014Biological Processmeristem initiation
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MLSMEEILCE LSRDDMNNEK GLPPGFRFHP TDEELITFYL ASKVFNGTFC GIQIAEVDLN  60
RCEPWELPEV AKMGEREWYF FSLRDRKYPT GLRTNRATGA GYWKATGKDR EVYSATNGAL  120
LGMKKTLVFY KGRAPKGEKT KWVMHEYRLD GDFSYRYSSK EEWVICRILH KIGEKKNPIY  180
QAAGQNYGYP TSLKTWPSSS FLNTAAPNPI LAETPNPKTT TTTHWQESFQ ISQNSVQSLH  240
NLYLFHHQEN DLMKSLFSPI NVSQTNLFPI NNSDLSSAAS FSTSQSTKKY KEDINKNSSI  300
SSFLFSNSFC TSKKNEKQQV PLMQANTTMK TEASFSPYSG CYNDQNPMAS TFGMNNSSDW  360
SLVGIEGMHF NGGCTQSQMV LDHMNCPIKI TAESWPLDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-512217120168NAC domain-containing protein 19
3swm_B2e-512217120168NAC domain-containing protein 19
3swm_C2e-512217120168NAC domain-containing protein 19
3swm_D2e-512217120168NAC domain-containing protein 19
3swp_A2e-512217120168NAC domain-containing protein 19
3swp_B2e-512217120168NAC domain-containing protein 19
3swp_C2e-512217120168NAC domain-containing protein 19
3swp_D2e-512217120168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00241DAPTransfer from AT1G76420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2553741e-171AB255374.1 Petunia x hybrida PhCUC3 mRNA for CUP-SHAPED COTYLEDON3, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009616121.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3
RefseqXP_016516166.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
TrEMBLA0ZSF81e-175A0ZSF8_PETHY; CUP-SHAPED COTYLEDON3
STRINGPGSC0003DMT4000256901e-153(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.13e-99NAC family protein